PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G226600.1
Common NamePHAVU_008G226600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 306aa    MW: 34857.5 Da    PI: 7.2351
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G226600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.55.4e-072671346
                        SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                         WT e+ +++  a + + ++   +W ++a++++ g+t  +++  ++ 
  Phvul.008G226600.1 26 EWTREDNKKFESALAIYDKDtpdRWFKVAAMIP-GKTVFDVIKQYRE 71
                        7********************************.****999999875 PP

2Myb_DNA-binding42.21.8e-13126170347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ +++ +  ++G+g+W+ I+r +  ++t+ q+ s+ qky
  Phvul.008G226600.1 126 PWTEEEHRRFLMGLLKYGKGDWRNISRNFVVTKTPTQVASHAQKY 170
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.4662277IPR017884SANT domain
SMARTSM007178.8E-92375IPR001005SANT/Myb domain
SuperFamilySSF466892.87E-112579IPR009057Homeodomain-like
CDDcd001675.95E-72672No hitNo description
PfamPF002491.0E-52671IPR001005SANT/Myb domain
PROSITE profilePS5129419.353119175IPR017930Myb domain
SuperFamilySSF466893.23E-16121175IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-17122174IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.608.3E-11123169IPR009057Homeodomain-like
SMARTSM007175.6E-11123173IPR001005SANT/Myb domain
CDDcd001676.42E-9126170No hitNo description
PfamPF002495.8E-11126170IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MELETLYPPC FMPDSNWFVQ ESHSTEWTRE DNKKFESALA IYDKDTPDRW FKVAAMIPGK  60
TVFDVIKQYR ELEEDVSEIE AGRVPIPGYL ASSFTFELVD NHNYDGCRRR PAPIRGSDQE  120
RKKGVPWTEE EHRRFLMGLL KYGKGDWRNI SRNFVVTKTP TQVASHAQKY YIRQKVSGGK  180
DKRRPSIHDI TTVNLTETAA SDKIKSPLFN LSPMITPQQK LNSMSKVQLD WTSHCNDGSL  240
MVFNPNTDNL FVSSSSDITS MALKMQGQDL YDCALHEAYA KIKVPGFGMA PRDFNNEAVF  300
GIHAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-1627891173RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007141798.10.0hypothetical protein PHAVU_008G226600g
SwissprotQ8S9H72e-93DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLV7B7D40.0V7B7D4_PHAVU; Uncharacterized protein
STRINGGLYMA14G06750.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.15e-94MYB family protein